You Searched For: Polydimethylsiloxane,+trimethylsiloxy+terminated


101 135  results were found

SearchResultCount:"101135"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (USBIT2750-04F)
Supplier: US Biological
Description: Anti-Terminal Deoxynucleotidyl Transferase Mouse Monoclonal Antibody (FITC (Fluorescein)) [clone: 7E150, 7E151]
UOM: 1 * 25 µG


Catalog Number: (USBIC7850-28)
Supplier: US Biological
Description: Anti-C5b-9 Terminal Complement Complex Mouse Monoclonal Antibody (FITC (Fluorescein)) [clone: 13A37]
UOM: 1 * 100 µl


Supplier: AGILENT
Description: Combine standard DNA components to build custom vector constructs from Agilent’s set of standard parts.

Catalog Number: (ABCAAB227821-100)
Supplier: Abcam
Description: Anti-cleaved C-terminal GSDMD Rabbit Monoclonal Antibody [clone: EPR20885-203]
UOM: 1 * 100 µl


Catalog Number: (ENZOENZ42630)
Supplier: ENZO LIFE SCIENCES
Description: BIOARRAY™ terminal labelling kit with Biotin-ddUTP has been developed for DNA probe array assays.
UOM: 1 * 1 KIT


Catalog Number: (USBIC7850-26)
Supplier: US Biological
Description: Anti-C5b-9 Terminal Complement Complex Mouse monoclonal antibody [clone: 9B1]
UOM: 1 * 100 µl


Catalog Number: (COBSD3-1866-50)
Supplier: Columbia Biosciences
Description: Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 50 µG


Catalog Number: (ABCAAB229564-100)
Supplier: Abcam
Description: Anti-TTF1/Transcription termination factor 1 Rabbit Polyclonal Antibody
UOM: 1 * 100 µl


Catalog Number: (BOSSBS-13260R-CY7)
Supplier: Bioss
Description: Terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals.
UOM: 1 * 100 µl


Catalog Number: (ABCAAB215203-100)
Supplier: Abcam
Description: Anti-cleaved N-terminal GSDMD Rabbit Monoclonal Antibody [clone: EPR20829-408]
UOM: 1 * 100 µl


Catalog Number: (BOSSBS-13260R-A555)
Supplier: Bioss
Description: Terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals.
UOM: 1 * 100 µl


Catalog Number: (BOSSBS-13260R-A488)
Supplier: Bioss
Description: Terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals.
UOM: 1 * 100 µl


Catalog Number: (BOSSBS-1714R-CY3)
Supplier: Bioss
Description: Amine transporter. Terminates the action of dopamine by its high affinity sodium-dependent reuptake into presynaptic terminals.
UOM: 1 * 100 µl


Catalog Number: (BOSSBS-13260R-HRP)
Supplier: Bioss
Description: Terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals.
UOM: 1 * 100 µl


Catalog Number: (BOSSBS-1714R-CY5.5)
Supplier: Bioss
Description: Amine transporter. Terminates the action of dopamine by its high affinity sodium-dependent reuptake into presynaptic terminals.
UOM: 1 * 100 µl


Catalog Number: (ABCAAB255603-100)
Supplier: Abcam
Description: Anti-cleaved C-terminal GSDMD Rabbit Monoclonal Antibody [clone: EPR20859-147]
UOM: 1 * 100 µl


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us on +353 1 88 22222.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us on +353 1 88 22222.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at eurega_services@eu.vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organisation. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
Product(s) marked with this symbol are discontinued - sold till end of stock. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service on +353 1 8822222.
81 - 96 of 101 135
no targeter for Bottom