You Searched For: Columbia Biosciences


218  results were found

SearchResultCount:"218"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (COBSD3-1866-50)
Supplier: Columbia Biosciences
Description: Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 50 µG


Supplier: Columbia Biosciences
Description: Anti-IgG Goat Polyclonal Antibody (RPE (R-Phycoerythrin))

New Transparency for European Customers

Have you noticed our new improved visibility on stock location at checkout?

Find out more

Enhancement to stock locations

Catalog Number: (COBSD8-1832)
Supplier: Columbia Biosciences
Description: Anti-T7 Tag Rabbit Polyclonal Antibody (DyLight® 488)
UOM: 1 * 100 µG


Catalog Number: (COBSD5-112-M)
Supplier: Columbia Biosciences
Description: Anti-IgM Goat Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 100 µG


Supplier: Columbia Biosciences
Description: Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: M2]

Supplier: Columbia Biosciences
Description: Anti-IgG Goat Polyclonal Antibody (RPE (R-Phycoerythrin))

Catalog Number: (COBSD5-112-FAB)
Supplier: Columbia Biosciences
Description: Anti-IgG Goat Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 100 µG


Catalog Number: (COBSD5-1830)
Supplier: Columbia Biosciences
Description: Anti-HA tag Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 100 µG


Catalog Number: (COBSD5-1831)
Supplier: Columbia Biosciences
Description: Anti-S Tag Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 100 µG


Catalog Number: (COBSD5-1834)
Supplier: Columbia Biosciences
Description: Anti-V5 Tag Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 100 µG


Catalog Number: (COBSD10-1832)
Supplier: Columbia Biosciences
Description: Anti-T7 Tag Rabbit Polyclonal Antibody (DyLight® 650)
UOM: 1 * 100 µG


Catalog Number: (COBSD10-1834)
Supplier: Columbia Biosciences
Description: Anti-V5 Tag Rabbit Polyclonal Antibody (DyLight® 650)
UOM: 1 * 100 µG


Catalog Number: (COBSB1-1722)
Supplier: Columbia Biosciences
Description: Anti-HA tag Mouse Monoclonal Antibody (Biotin) [clone: 16B12]
UOM: 1 * 100 µG


Catalog Number: (COBSD3-112-2A)
Supplier: Columbia Biosciences
Description: Anti-IgG2a Goat Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 100 µG


Catalog Number: (COBSD3-1602B)
Supplier: Columbia Biosciences
Description: Mouse IgG2b Isotype Control (APC (Allophycocyanin))
UOM: 1 * 100 µG


Catalog Number: (COBSD3-110-M)
Supplier: Columbia Biosciences
Description: Anti-IgM Goat Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 100 µG


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us on +353 1 88 22222.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us on +353 1 88 22222.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at eurega_services@eu.vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organisation. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
Product(s) marked with this symbol are discontinued - sold till end of stock. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service on +353 1 8822222.
1 - 16 of 218
no targeter for Bottom