Print…

You Searched For: Columbia+Biosciences


23 585  results were found

Refine Results Sort by
SearchResultCount:"23585"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-COBSD5-1762

Anti-Acetyl Lysine Mouse Monoclonal Antibody (RPE (R-Phycoerythrin)) [clone: 7F8]

Catalog Number: (COBSD5-1762)
Supplier: Columbia Biosciences
Description: Anti-Acetyl Lysine Mouse Monoclonal Antibody (RPE (R-Phycoerythrin)) [clone: 7F8]
UOM: 1 * 100 µG
Image Unavailable-COBSD11-1714

Anti-c-Myc tag Mouse Monoclonal Antibody (Peridinin Chlorophyll) [clone: 9E10]

Catalog Number: (COBSD11-1714)
Supplier: Columbia Biosciences
Description: Anti-c-Myc tag Mouse Monoclonal Antibody (Peridinin Chlorophyll) [clone: 9E10]
UOM: 1 * 100 µG
Image Unavailable-COBSD7-1714

Anti-c-Myc tag Mouse Monoclonal Antibody SureLight® P3 [clone: 9E10]

Catalog Number: (COBSD7-1714)
Supplier: Columbia Biosciences
Description: Anti-c-Myc tag Mouse Monoclonal Antibody SureLight® P3 [clone: 9E10]
UOM: 1 * 100 µG
Image Unavailable-COBSD3-1714-100

Anti-c-Myc tag Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: 9E10]

Catalog Number: (COBSD3-1714-100)
Supplier: Columbia Biosciences
Description: Anti-c-Myc tag Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: 9E10]
UOM: 1 * 100 µG
Image Unavailable-COBSD5-1866-50

Anti-EP4 receptor C-terminal Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))

Catalog Number: (COBSD5-1866-50)
Supplier: Columbia Biosciences
Description: Anti-EP4 receptor C-terminal Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 50 µG
Product Image-471-0842

ATEX Freezers, Bioline range

Supplier: GRAM
Description: BioLine is a comprehensive refrigeration range designed to deal with special bioscience needs. BioLine is distinct from other 'spark-free' freezers on the market, as both the interior and the exterior of all units have been shown to comply with the European guidelines contained in the ATEX [EN/IEC60079-15] directive which means they are safe for use in potentially explosive atmospheres (Zone 2 [Category 3]). The unique air distribution system is combined with BioLine’s innovative 'smart defrost' function to maintain temperature consistency for biostorage: Smart defrost is an intelligent automatic defrosting control that makes sure the absolute minimum of time and energy is used during each defrost cycle. Whilst the air distribution system which directs the cold air down a special plate to the rear of the cabinet interior and back up to the evaporator fan mounted in the top, ensures a uniform temperature throughout using only a minimum of energy. And by also using cyclopentane to foam the insulation material and hydrocarbon refrigerants, BioLine storage solutions have only minimal environmental impact.

Image Unavailable-COBSD3-1866-50

Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))

Catalog Number: (COBSD3-1866-50)
Supplier: Columbia Biosciences
Description: Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 50 µG
Image Unavailable-COBSD5-1310

Anti-schistosomal Glutathione-S-transferase Goat Polyclonal Antibody (RPE (R-Phycoerythrin))

Catalog Number: (COBSD5-1310)
Supplier: Columbia Biosciences
Description: Anti-schistosomal Glutathione-S-transferase Goat Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 100 µG
Image Unavailable-COBSD10-1310-100

Anti-schistosomal Glutathione-S-Transferase Goat Polyclonal Antibody (DyLight® 650)

Catalog Number: (COBSD10-1310-100)
Supplier: Columbia Biosciences
Description: Anti-schistosomal Glutathione-S-Transferase Goat Polyclonal Antibody (DyLight® 650)
UOM: 1 * 100 µG
Image Unavailable-COBSHRP-1711

Anti-6X His tag Mouse Monoclonal Antibody HRP (Horseradish Peroxidase) [clone: AD1.1.10]

Catalog Number: (COBSHRP-1711)
Supplier: Columbia Biosciences
Description: Anti-6X His tag Mouse Monoclonal Antibody HRP (Horseradish Peroxidase) [clone: AD1.1.10]
UOM: 1 * 100 µG
Image Unavailable-COBSD3-1760

Anti-cytokeratins 4, 5, 6, 8, 10, 13, and 18 Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: C11]

Catalog Number: (COBSD3-1760)
Supplier: Columbia Biosciences
Description: Anti-cytokeratins 4, 5, 6, 8, 10, 13, and 18 Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: C11]
UOM: 1 * 100 µG
Image Unavailable-COBSAP-1718

Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (AP (Alkaline Phosphatase)) [clone: M2]

Catalog Number: (COBSAP-1718)
Supplier: Columbia Biosciences
Description: Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (AP (Alkaline Phosphatase)) [clone: M2]
UOM: 1 * 100 µG
Image Unavailable-COBSD11-1711

Anti-6X His tag Mouse Monoclonal Antibody (Peridinin Chlorophyll) [clone: AD1.1.10]

Catalog Number: (COBSD11-1711)
Supplier: Columbia Biosciences
Description: Anti-6X His tag Mouse Monoclonal Antibody (Peridinin Chlorophyll) [clone: AD1.1.10]
UOM: 1 * 100 µG
Image Unavailable-COBSD9-1722

Anti-HA tag Mouse Monoclonal Antibody (DyLight® 550) [clone: 16B12]

Catalog Number: (COBSD9-1722)
Supplier: Columbia Biosciences
Description: Anti-HA tag Mouse Monoclonal Antibody (DyLight® 550) [clone: 16B12]
UOM: 1 * 100 µG

Certificates


Image Unavailable-COBSD5-1714

Anti-c-Myc tag Mouse Monoclonal Antibody (RPE (R-Phycoerythrin)) [clone: 9E10]

Catalog Number: (COBSD5-1714)
Supplier: Columbia Biosciences
Description: Anti-c-Myc tag Mouse Monoclonal Antibody (RPE (R-Phycoerythrin)) [clone: 9E10]
UOM: 1 * 100 µG
Image Unavailable-COBSD17-1714-1MG

Anti-c-Myc tag Mouse Monoclonal Antibody (Europium 1024) [clone: 9E10]

Supplier: Columbia Biosciences
Description: Anti-c-Myc tag Mouse Monoclonal Antibody (Europium 1024) [clone: 9E10]

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us on +353 1 88 22222.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us on +353 1 88 22222.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at eurega_services@eu.vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organisation. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
Product(s) marked with this symbol are discontinued - sold till end of stock. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service on +353 1 8822222.
305 - 320 of 23 585
no targeter for Bottom